Multi-omics data pipeline for CPTAC3 (Clinical Proteomic Tumor Analysis Consortium). Downloads and processes matched genomics (WXS BAM files from GDC) and proteomics (TMT-labeled RAW files from PDC) data for integrated analysis of amino acid substitutions.
AAS_Evo/
├── config/
│ └── paths.py # Environment-aware path config
├── metadata/ # Tracked metadata (in-repo)
│ ├── studies.tsv # Study registry (tissue → PDC study ID)
│ ├── GDC_meta/ # GDC manifests & sample metadata
│ │ └── manifests/manifest_wxs_bams.tsv
│ ├── PDC_meta/ # PDC per-tissue CSVs & consolidated files
│ │ ├── {tissue}/PDC_file_manifest.csv
│ │ ├── {tissue}/PDC_study_biospecimen.csv
│ │ └── {tissue}/PDC_study_experimental.csv
│ ├── Tsour_et_al/ # External AAS dataset (Tsour et al.)
│ │ ├── pep_to_protein.csv # SAAP → protein/gene/position mapping
│ │ └── peptide_to_patient.csv # SAAP → patient/TMT set/RAAS
│ └── mapping_report.tsv # GDC↔PDC matching report
├── scripts/
│ ├── setup/
│ │ ├── setup_metadata.sh # Orchestrator: fetch all metadata from APIs
│ │ ├── setup_seq_files.sh # Download all external reference files
│ │ ├── fetch_gdc_manifest.py # Query GDC REST API for WXS BAM manifest
│ │ └── fetch_pdc_metadata.py # Query PDC GraphQL API for per-tissue metadata
│ ├── download/
│ │ ├── gdc/
│ │ │ ├── submit_download.sh # Submit SLURM download jobs
│ │ │ ├── download_chunk.sh # Single-chunk SLURM download job
│ │ │ ├── download.py # GDC download via gdc-client
│ │ │ ├── fetch_metadata.py # Fetch sample metadata from GDC API
│ │ │ ├── fetch_unmatched_bams.py # Find WXS BAMs for unmatched PDC patients
│ │ │ └── setup_chunks.sh # Split manifest into chunks
│ │ ├── pdc/
│ │ │ ├── submit_download.sh # SLURM job wrapper
│ │ │ ├── download.py # PDC download (rate-limited)
│ │ │ ├── refresh_urls.py # Refresh expired PDC signed URLs via API
│ │ │ └── consolidate_metadata.py # Merge per-tissue CSVs
│ │ └── mapping_report.py # GDC-PDC sample matching
│ ├── proc_bams/
│ │ ├── run_pipeline.sh # Wrapper: auto-generates file lists + submits jobs
│ │ ├── submit_variant_call.sh # SLURM array: variant calling
│ │ ├── submit_vep.sh # SLURM array: VEP annotation + AlphaMissense
│ │ └── consolidate_missense.sh # Merge missense mutations
│ ├── mutation_analysis/ # Filtering, SPURS, MSA generation & coevolution
│ │ ├── filter_and_rank.py
│ │ ├── spurs_predict_per_gene.py # SPURS ddG stability predictions (+ pLDDT extraction)
│ │ ├── submit_spurs_scores.sh # SLURM array job for SPURS
│ │ ├── add_spurs_to_missense_table.py # Merge spurs_ddg into missense table
│ │ ├── backfill_plddt.py # Add pLDDT to existing ddg_matrix files from cached PDBs
│ │ ├── make_unique_missense_table.py # Collapse to one row per unique mutation + SPURS + pLDDT
│ │ ├── generate_msas.py
│ │ ├── submit_msa_generation.sh
│ │ ├── build_msa_gene_list.py
│ │ ├── coevolution_analysis.py
│ │ ├── submit_coevolution.sh
│ │ ├── saap_missense_cooccurrence.py # SAAP × missense co-occurrence (per TMT set)
│ │ ├── saap_cooccurrence_am_analysis.py # AM score distribution for co-occurring mutations
│ │ └── saap_evcoupling_analysis.py # SAAP × EVCouplings × missense coupling check
│ ├── fasta_gen/ # Custom proteogenomics FASTAs
│ │ ├── generate_mutant_fastas.py
│ │ ├── combine_plex_fastas.py
│ │ ├── generate_compensatory_fastas.py
│ │ ├── submit_compensatory_fastas.sh
│ │ └── submit_proteogenomics.sh
│ └── ms_search/ # FragPipe MS database search
│ └── fragpipe/
│ ├── run_ms_search.sh # Orchestrator: setup + submit SLURM array
│ ├── generate_manifests.py # Generate per-plex manifests + patch workflows
│ ├── add_decoys.py # Append rev_ decoy sequences to FASTAs
│ ├── submit_fragpipe.sh # SLURM array job (one plex per task)
│ └── validation.ipynb # Channel enrichment validation notebook
└── .claude/
└── CLAUDE.md # Detailed project context
/scratch/leduc.an/AAS_Evo/
├── BAMS/ # GDC BAM files (by UUID subdirectory)
├── RAW/ # PDC RAW files (flattened)
├── VCF/ # Variant calls (per-chunk subdirectories)
│ ├── chunk_00/ # VCFs from first BAM chunk
│ └── chunk_01/ ...
├── VEP/ # VEP annotations (per-chunk subdirectories)
│ ├── chunk_00/ # VEP output from first chunk
│ ├── chunk_01/ ...
│ └── all_missense_mutations.tsv # Consolidated (top-level)
├── SEQ_FILES/ # Reference files
│ ├── hg38.fa # Human reference genome (GRCh38)
│ ├── cds.chr.bed # CDS regions for targeted variant calling
│ ├── uniprot_human_canonical.fasta # UniProt reviewed proteome
│ ├── uniref50 # MMseqs2 UniRef50 database
│ └── AlphaMissense_hg38.tsv.gz # AlphaMissense pathogenicity data
├── ANALYSIS/ # Mutation filtering, ranking & SAAP analysis output
│ ├── ranked_mutations.tsv
│ ├── top_5000_mutations.tsv
│ ├── all_missense_with_spurs.tsv # Full per-sample missense + spurs_ddg
│ ├── unique_missense_mutations.tsv # One row per unique mutation + spurs_ddg + plddt
│ ├── gene_list_for_msa.txt
│ ├── gene_list_for_spurs_all.txt # All missense-table genes not yet in SPURS
│ └── saap_cooccurrence/ # SAAP co-occurrence analysis outputs
│ ├── saap_set_summary.tsv
│ ├── saap_missense_cooccurrence.tsv
│ ├── evc_coverage.tsv
│ ├── evc_cooccurrence.tsv
│ └── evc_summary.txt
├── FASTA/ # Custom proteogenomics FASTAs
│ ├── per_sample/ # Per-sample mutant entries
│ ├── per_plex/ # Reference + plex-specific mutants + compensatory
│ └── compensatory/ # Predicted compensatory mutation entries
├── SPURS/ # SPURS ddG stability predictions
│ ├── pdb_cache/ # AlphaFold PDB files (cached per gene)
│ ├── ddg_matrices/ # {ACC}.{GENE}.ddg_matrix.tsv (pos × 20 AA, with plddt column)
│ └── hf_cache/ # HuggingFace model cache
├── MSA/ # Per-gene multiple sequence alignments (A3M)
├── COEVOL/ # Coevolution analysis output
├── MS_SEARCH/ # FragPipe MS search setup & results
│ ├── manifests/ # Per-plex .fp-manifest files
│ ├── annotations/ # Per-plex TMT channel annotations
│ └── results/ # Per-plex FragPipe output
└── logs/ # SLURM job logs
Download BAMs → Variant Call → VEP (+ AlphaMissense) → Consolidate
↓ ↓
↓ All Missense Mutations
↓ ↓
↓ SPURS ddG Predictions (per gene, + pLDDT)
↓ ↓
↓ Unique Missense Table (gene×swap, with scores)
↓ ↓
↓ SAAP Co-occurrence Analysis (Tsour et al.)
↓ ↓ ↓
↓ AM Score Analysis EVCouplings Check
↓ ↓
Filter & Rank (top 5000) Per-Sample Mutant FASTAs
↓ ↓
Generate MSAs (MMseqs2) ↓
↓ ↓
Coevolution Analysis ↓
↓ ↓
Compensatory FASTAs ─────────────────────────────────────→ ↓
↓
Combine Per-Plex FASTAs (ref + observed + compensatory)
↓
FragPipe MS Search (per plex)
Fetches all metadata from GDC and PDC APIs programmatically. No manual portal downloads needed.
bash scripts/setup/setup_metadata.shThis runs six steps automatically:
- GDC manifest — queries GDC REST API for all CPTAC WXS BAM files (projects from
studies.tsv) - GDC metadata — enriches manifest with case/sample info
- PDC metadata — queries PDC GraphQL API for file manifests, biospecimen data, and TMT plex layouts (all 12 tissues)
- Consolidate — merges per-tissue PDC CSVs into unified files
- Matching — cross-references GDC↔PDC samples, generates pruned manifests
- Recover unmatched — finds WXS BAMs for PDC patients missing from the initial GDC manifest, merges them in, and re-runs matching
To add a new tissue/study, add a row to metadata/studies.tsv and re-run.
GDC token: BAM downloads require dbGaP authorization. Download your token from the GDC portal (username → Download Token) and pass the file path to submit_download.sh. The token is NOT needed for this metadata setup step.
Downloads and indexes all external reference files (~100 GB total):
# As SLURM job (recommended for large downloads):
sbatch scripts/setup/setup_seq_files.sh
# Or skip large files (UniRef90, VEP) for initial testing:
bash scripts/setup/setup_seq_files.sh --skip-largeDownloads: hg38 genome, GENCODE CDS regions, UniProt canonical proteome, AlphaMissense data, UniRef90 database, and VEP container + cache.
BAMs are downloaded in chunks of ~400 to stay within storage limits:
# One-time: split manifest into chunks (400 BAMs each, tissue-only)
bash scripts/download/gdc/setup_chunks.sh 400 path/to/manifest_wxs_bams_tissue.tsv
# Per chunk (repeat for each chunk manifest):
bash scripts/download/gdc/submit_download.sh path/to/chunks/chunk_00.tsvPDC RAW files (open access):
sbatch scripts/download/pdc/submit_download.shProcesses all BAMs currently in BAMS/, outputs to per-chunk subdirectories (VCF/chunk_00/, VEP/chunk_00/):
# Step 1: Variant calling (finds BAMs automatically, outputs to VCF/chunk_00/)
bash scripts/proc_bams/run_pipeline.sh variant-call chunk_00
# Step 2: VEP annotation with AlphaMissense (reads VCF/chunk_00/, outputs to VEP/chunk_00/)
bash scripts/proc_bams/run_pipeline.sh vep chunk_00
# Step 3: Delete BAMs, download next chunk, repeat with chunk_01, etc.
rm -rf /scratch/leduc.an/AAS_Evo/BAMS/*VCF/VEP outputs persist across chunks in their subdirectories. Both scripts skip already-processed samples.
Final output (all_missense_mutations.tsv, 18 columns): sample_id, genomic position, consequence, gene symbol, protein change (HGVSp), amino acid swap, gnomADe_AF, AlphaMissense pathogenicity + class, read depths, VAF.
# After ALL chunks are processed: merge per-sample VEP TSVs
bash scripts/proc_bams/consolidate_missense.sh
# Rank mutations by composite pathogenicity score (AlphaMissense, gnomAD, recurrence)
python3 scripts/mutation_analysis/filter_and_rank.py \
--vep-tsv /scratch/leduc.an/AAS_Evo/VEP/all_missense_mutations.tsv \
--ref-fasta /scratch/leduc.an/AAS_Evo/SEQ_FILES/uniprot_human_canonical.fasta \
-o /scratch/leduc.an/AAS_Evo/ANALYSISOutput: ANALYSIS/top_5000_mutations.tsv, ANALYSIS/gene_list_for_msa.txt (used automatically by downstream steps).
SPURS predicts per-position ddG (stability change) for all 20 amino acid substitutions using AlphaFold structures. The ddG matrix includes a plddt column (AlphaFold per-residue confidence, 0–100) for quality filtering — only trust ddG at positions with pLDDT > 70.
# One-time setup
bash scripts/mutation_analysis/setup_spurs_env.sh
# Generate gene list of all genes in missense table not yet computed
awk -F'\t' 'NR>1 {print $7}' /scratch/leduc.an/AAS_Evo/VEP/all_missense_mutations.tsv \
| sort -u > /tmp/all_missense_genes.txt
ls /scratch/leduc.an/AAS_Evo/SPURS/ddg_matrices/*.ddg_matrix.tsv \
| xargs -n1 basename | awk -F'.' '{print $2}' | sort -u > /tmp/done_genes.txt
comm -23 /tmp/all_missense_genes.txt /tmp/done_genes.txt \
> /scratch/leduc.an/AAS_Evo/ANALYSIS/gene_list_for_spurs_all.txt
# Submit in batches of 1000 (Discovery array limit)
NUM=15621 # replace with actual wc -l output
BATCH=1000
for offset in $(seq 0 $BATCH $((NUM - 1))); do
remaining=$((NUM - offset))
size=$((remaining < BATCH ? remaining : BATCH))
GENE_OFFSET=$offset sbatch --array=1-${size}%20 \
scripts/mutation_analysis/submit_spurs_scores.sh
done
# Backfill pLDDT into existing ddg_matrix files (no model needed, reads cached PDBs)
srun ... python scripts/mutation_analysis/backfill_plddt.pyOutput: SPURS/ddg_matrices/{ACC}.{GENE}.ddg_matrix.tsv — columns: pos_1based, wt_aa, plddt, to_A … to_Y
After all SPURS jobs complete, build the lightweight unique mutation table:
python3 scripts/mutation_analysis/make_unique_missense_table.py \
--missense /scratch/leduc.an/AAS_Evo/VEP/all_missense_mutations.tsv \
--spurs-dir /scratch/leduc.an/AAS_Evo/SPURS \
-o /scratch/leduc.an/AAS_Evo/ANALYSIS/unique_missense_mutations.tsvOutput: one row per unique (gene, swap) with spurs_ddg, plddt, am_pathogenicity, n_samples, mean_vaf.
Cross-references the Tsour et al. AAS dataset with our CPTAC missense calls to ask: for each aberrant amino acid substitution (AAS/SAAP) detected by MS in a TMT set, does any patient in that set carry a genomic missense in the same gene?
Input data (metadata/Tsour_et_al/):
pep_to_protein.csv— maps each SAAP to its gene, protein, and positionpeptide_to_patient.csv— maps each SAAP to the patients/TMT sets it was detected in, with RAAS (relative AAS abundance)
# Step 1: SAAP × missense co-occurrence (per TMT set)
srun ... python scripts/mutation_analysis/saap_missense_cooccurrence.py \
--missense /scratch/leduc.an/AAS_Evo/ANALYSIS/all_missense_with_spurs.tsv
# Outputs: saap_set_summary.tsv, saap_missense_cooccurrence.tsv
# Step 2: AM score distribution (co-occurring vs background)
# Co-occurring = missense in SAAP-affected genes, same-set patients
# Background = missense in non-SAAP genes, same patients & sets
srun ... python scripts/mutation_analysis/saap_cooccurrence_am_analysis.py \
--missense /scratch/leduc.an/AAS_Evo/ANALYSIS/all_missense_with_spurs.tsv
# Step 3: EVCouplings coupling check
# For co-occurring pairs, checks if the missense position is evolutionarily
# coupled to the SAAP position using precomputed EVChits files (ENSP-level)
srun ... python scripts/mutation_analysis/saap_evcoupling_analysis.py
# Outputs: evc_coverage.tsv, evc_cooccurrence.tsv, evc_summary.txtEVChits files are located at /projects/marubi/collabs/slavov_rna/evcouplings_files/EVChits/ on Discovery. Each file (ENSP*_EVChits.csv) contains evolutionary coupling pairs for SAAP positions in that protein, with mad_score and probability columns as confidence metrics.
# Submit MSA generation (auto-finds gene list from ANALYSIS/)
NUM_GENES=$(wc -l < /scratch/leduc.an/AAS_Evo/ANALYSIS/gene_list_for_msa.txt)
sbatch --array=1-${NUM_GENES}%10 scripts/mutation_analysis/submit_msa_generation.shMSA files named by UniProt accession (P04637.a3m). Pre-existing MSAs are auto-detected and skipped.
Predicts compensatory translation errors using EVcouplings/Direct Coupling Analysis (DCA). Given a destabilizing missense mutation at position i, uses the Potts model coupling tensor J(i,a;j,b) to identify covarying positions and predict which amino acid substitution could compensate.
Method: Mean-field DCA computes evolutionary couplings between all position pairs. The coupling parameters directly encode which amino acid combinations are evolutionarily preferred, enabling more accurate compensatory predictions than simple mutual information.
# After MSA generation completes (auto-finds gene list from ANALYSIS/):
sbatch scripts/mutation_analysis/submit_coevolution.shOutput: COEVOL/compensatory_predictions.tsv
# After coevolution analysis completes:
sbatch scripts/fasta_gen/submit_compensatory_fastas.shOutput: FASTA/compensatory/all_compensatory.fasta — tryptic peptides containing both the original destabilizing mutation and the predicted compensatory substitution.
# Generate per-sample mutant FASTAs + per-plex search databases
# Automatically includes compensatory entries if FASTA/compensatory/ exists
sbatch scripts/fasta_gen/submit_proteogenomics.shCreates custom MS search databases per TMT plex: reference proteome + plex-specific mutant tryptic peptides + plex-specific compensatory peptides.
Tryptic peptide approach: Instead of adding full mutant proteins (~500 AA each), the pipeline extracts only tryptic peptides containing mutations (~15 AA avg). This minimizes database size and improves FDR statistics.
FASTA headers — two formats exist at different stages:
Per-sample FASTAs (FASTA/per_sample/) use a simple internal format:
>mut|P04637|TP53|R273H|genetic
SVTCTYSPALNKMFCQLAK
Per-plex FASTAs (FASTA/per_plex/) are rebuilt by combine_plex_fastas.py into a Philosopher-compatible mock-UniProt format required for FragPipe:
>sp|P04637-R273H-A3F2|TP53-mut TP53 mutant R273H OS=Homo sapiens OX=9606 GN=TP53 PE=1 SV=1
>sp|P04637-comp-R273H-G245S-A3F2|TP53-comp TP53 compensatory R273H_G245S OS=Homo sapiens OX=9606 GN=TP53 PE=1 SV=1
The accession field structure is {UniProtID}-{swap}-{4-char-seq-hash}. The hash disambiguates multiple tryptic peptides for the same mutation (different missed cleavage contexts). See the FASTA structure section below for why this format is required.
FragPipe is the primary tool for the MS database search. Each TMT plex is searched independently against its own custom FASTA (reference + plex-specific mutant peptides + compensatory peptides).
FragPipe requires several components to be installed together. The pipeline was developed and validated with FragPipe 24.0.
Required components (all managed via the FragPipe GUI on first install):
- FragPipe 24.0 — main orchestrator (
fragpipe-24.0/bin/fragpipe) - MSFragger — database search engine (bundled with FragPipe)
- Philosopher — statistical validation and reporting (bundled with FragPipe)
- IonQuant / TMT-Integrator — TMT reporter ion quantification (bundled with FragPipe)
- Java 17 — required runtime (
jdk-17.0.18+8used here; setJAVA_HOME)
Note: The exact versions of MSFragger, Philosopher, and IonQuant bundled with FragPipe 24.0 should be noted here — check the FragPipe GUI's Tools tab for what was actually used.
Installation paths are configured in submit_fragpipe.sh:
FRAGPIPE_BIN=/home/leduc.an/bin/fragpipe-24.0/bin/fragpipe
FRAGPIPE_TOOLS=/home/leduc.an/bin/fragpipe-24.0/tools
JAVA_HOME=/home/leduc.an/bin/jdk-17.0.18+8FragPipe requires decoy sequences in the search database (target-decoy FDR estimation). The pipeline maintains two separate copies of the per-plex FASTAs:
FASTA/per_plex/— clean FASTAs, no decoys (used by MaxQuant if needed)FASTA/per_plex_fragpipe/— FASTAs with reversed decoy entries appended (rev_prefix)
run_ms_search.sh runs add_decoys.py automatically to generate the FragPipe copies. Decoys are full sequence reversals (not shuffled), prefixed with rev_. FragPipe detects decoys by this prefix.
The per-plex FASTA contains four entry types:
# Standard reference proteins (passed through from UniProt)
>sp|P04637|P53_HUMAN Cellular tumor antigen p53 ... GN=TP53 PE=1 SV=4
MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDP...
# Observed mutant tryptic peptides (Philosopher-compatible mock-UniProt format)
>sp|P04637-R273H-A3F2|TP53-mut TP53 mutant R273H OS=Homo sapiens OX=9606 GN=TP53 PE=1 SV=1
SVTCTYSPALNKMFCQLAK
# Compensatory mutation peptides
>sp|P04637-comp-R273H-G245S-A3F2|TP53-comp TP53 compensatory R273H_G245S OS=Homo sapiens OX=9606 GN=TP53 PE=1 SV=1
VVRCPHHERCSDSDGLAPPQHLIRVEGNLHAEYLDDQQFIFHSVVVPYEPPEVGSDCTTIHYNYMCNS
# Reversed decoys (appended by add_decoys.py)
>rev_sp|P04637|P53_HUMAN ...
Why this specific header format: Philosopher classifies FASTA entries by accession format during philosopher database --annotate. Entries with non-UniProt accessions (e.g. MUT_P04637_R273H) are classified as "generic" proteins and skipped — they never appear in db.bin, causing the filter step to crash with "protein not in database" errors. Using the real UniProt accession as the base (P04637-R273H-HASH) causes Philosopher to classify the entry as a UniProt variant, store it in db.bin, and handle it correctly throughout the pipeline. The GN= field is separately required by TMT-Integrator for gene-level intensity reports. Underscores in the accession field also break Philosopher's parser, which is why compensatory swap combos use dashes (R273H-G245S) not underscores in the accession field.
Mutant and compensatory entries are single tryptic peptides (~15 AA avg), not full proteins. Any mutant peptide that is a substring of its parent reference protein is filtered out at this stage — MSFragger matches by sequence, so a shared substring would assign the PSM to the reference entry and cause Philosopher to crash looking up the mutant accession.
The FragPipe workflow is a .workflow file exported from the FragPipe GUI. Key settings used:
- Search type: TMT-11 closed search
- TMT channels: 11-plex (126–131C); forced via
tmtintegrator.channel_num=TMT-11patch ingenerate_manifests.py - Decoy prefix:
rev_(must match whatadd_decoys.pyuses) - Protein FDR: default template value (standard
--prot 0.05)
Note: The specific search parameters in the workflow (precursor/fragment mass tolerances, variable modifications, enzyme, missed cleavages, etc.) are set in the
.workflowfile on the cluster. These should be documented here once confirmed — export the workflow from the FragPipe GUI and check the MSFragger section.
To create the workflow:
- Open FragPipe GUI on a machine with the RAW files accessible (or use a test file)
- Load files → select TMT-11 experiment type
- Configure MSFragger search parameters for closed search
- Enable Philosopher (PeptideProphet, ProteinProphet) and TMT-Integrator
- Export workflow → save as
fragpipe.workflow - Copy to the cluster and pass to
run_ms_search.sh
# Step 1: Set up per-plex manifests + copy FASTAs with decoys + submit jobs
bash scripts/ms_search/fragpipe/run_ms_search.sh /path/to/template.workflow
# Or: generate manifests first, add workflow manually, then submit
bash scripts/ms_search/fragpipe/run_ms_search.sh
# -> place workflow at MS_SEARCH/fragpipe.workflow, then:
NUM_PLEXES=$(wc -l < /scratch/leduc.an/AAS_Evo/MS_SEARCH/plex_list.txt)
sbatch --array=1-${NUM_PLEXES}%5 scripts/ms_search/fragpipe/submit_fragpipe.shrun_ms_search.sh does three things automatically:
- Copies per-plex FASTAs to
FASTA/per_plex_fragpipe/withrev_decoys appended - Generates per-plex
.fp-manifestfiles and TMT channel annotation files - Patches per-plex workflow files with the correct FASTA path and TMT-11 channel count
Each SLURM job: 16 CPUs, 64 GB RAM, 24h time limit, 5 plexes concurrent.
Results are written to MS_SEARCH/results/{plex_id}/. Key output files:
{plex_id}_1/psm.tsv— PSM-level results with TMT reporter intensitiescombined_protein.tsv— protein-level summary (Philosopher)experiment_annotation.tsv— TMT channel → patient ID mapping (copied fromannotations/)
Search completion is detected by the presence of combined_protein.tsv. Re-submitting the array job safely skips completed plexes.
All reference files are downloaded and indexed by scripts/setup/setup_seq_files.sh. They live in /scratch/leduc.an/AAS_Evo/SEQ_FILES/:
| File | Source | Size |
|---|---|---|
hg38.fa + .fai |
UCSC Genome Browser (chr-prefix, matching GDC BAMs) | ~3 GB |
cds.chr.bed |
GENCODE v46 CDS regions (merged, standard chromosomes) | ~2 MB |
uniprot_human_canonical.fasta |
UniProt reference proteome UP000005640 (reviewed, canonical) | ~25 MB |
AlphaMissense_hg38.tsv.gz + .tbi |
DeepMind AlphaMissense pathogenicity predictions | ~6 GB |
uniref50 (MMseqs2 db) |
UniProt Reference Clusters at 50% identity | ~60 GB |
| VEP container + cache | Ensembl VEP Apptainer image | ~15 GB |
Genomics pipeline:
- Python 3.8+, pandas, numpy
gdc-client(GDC Data Transfer Tool, for controlled-access BAM downloads)samtools,bcftools(variant calling)bedtools(for generating CDS BED from GENCODE annotation)htslib/tabix(AlphaMissense indexing)- Ensembl VEP via Apptainer container (annotation + AlphaMissense plugin)
Coevolution pipeline:
mmseqs2(MSA generation against UniRef50)
MS search pipeline:
- FragPipe 24.0 with bundled MSFragger, Philosopher, and IonQuant/TMT-Integrator
- Java 17 (required by FragPipe/MSFragger)
- Workflow file configured for TMT-11 closed search (exported from FragPipe GUI)
| Source | Data Type | Access | Files |
|---|---|---|---|
| GDC | WXS BAM files | Controlled (dbGaP) | ~2,098 matched |
| PDC | TMT RAW files | Open (signed URLs) | ~5,020 matched |
MIT License